PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.28243s0044.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 820aa    MW: 91270.5 Da    PI: 5.2618
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.28243s0044.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.91.2e-20111166156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +++ +++t+ q++e+e+lF++n++p+ ++r++L+++lgL+ rqVk+WFqNrR+++k
  Bostr.28243s0044.1.p 111 KKRYHRHTNRQIQEMEALFKENPHPDDKQRKRLSAELGLKPRQVKFWFQNRRTQMK 166
                           688999***********************************************998 PP

2START1432.9e-453195521206
                           HHHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGG CS
                 START   1 elaeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddke 70 
                           e+a ++ qel k+ + eep+W k            +n++e+++ f                ++ ea++a +vv+m++ +lv  +l+   
  Bostr.28243s0044.1.p 319 EIAVSCVQELTKMCDTEEPLWIKKKsdkiggeiLCLNEEEYIRLF----PwpvenhnnkgdFRREASKANAVVIMNSITLVDAFLNAD- 402
                           578899****************99966565544445566666655....0445677899999**************************. PP

                           CT-TT-S....EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE..-TTS--.....-TTS CS
                 START  71 qWdetla....kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvd..seqkppe....sssv 142
                           +W+e++     +a+t++ issg     g l lm+aelq+lsplvp R+ +f+Ry +q  + g w+ivd  +d  ++q++p      +++
  Bostr.28243s0044.1.p 403 KWSEMFCsivaRAKTVQIISSGvsgasGSLLLMYAELQVLSPLVPtREAYFLRYVEQnTENGNWAIVDFPIDsfHDQMQPLntntPHEY 491
                           ******99999**********************************************99**********99944467777674434455 PP

                           EE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 143 vRaellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                            R    pSg++i++++ng+s+v wvehv+++++++h+ +   vksg+a+ga++w+  lqrqce+
  Bostr.28243s0044.1.p 492 TR---KPSGCIIQDMPNGYSQVKWVEHVEVDEKHVHETFAEYVKSGMAFGANRWLDVLQRQCER 552
                           55...*********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.6E-20100169IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-21105174IPR009057Homeodomain-like
PROSITE profilePS5007117.589108168IPR001356Homeobox domain
SMARTSM003891.4E-18109172IPR001356Homeobox domain
CDDcd000864.51E-19111169No hitNo description
PfamPF000463.5E-18111166IPR001356Homeobox domain
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PROSITE profilePS5084843.348310555IPR002913START domain
SuperFamilySSF559611.79E-30311554No hitNo description
CDDcd088751.04E-106314551No hitNo description
SMARTSM002341.3E-26319552IPR002913START domain
PfamPF018529.7E-38320552IPR002913START domain
SuperFamilySSF559612.06E-15590799No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 820 aa     Download sequence    Send to blast
MLTIGEGNVM TSDNMRFASQ PPSSSSPGTI QNPNFNFIPF NSFSSIIPKE ENVMMSMMMM  60
MGDGTVEEMM ENGSAGGSFG SGSEQAEDPK FGNESDVNEL QDDEQPPPAK KKRYHRHTNR  120
QIQEMEALFK ENPHPDDKQR KRLSAELGLK PRQVKFWFQN RRTQMKAQQD RTENVMLRAE  180
NDNLKSENCH LQAELRCLSC PSCGGPTVLG DIPFNELHIE NCRLREELDR LCCIASRYTG  240
RPMQSMPSSQ PLINASPTLP HHQPSLELDM SVYAGNFPEH SCADMMMLPP QDTACFFPDQ  300
TANNNNMLLA DEEKVIAMEI AVSCVQELTK MCDTEEPLWI KKKSDKIGGE ILCLNEEEYI  360
RLFPWPVENH NNKGDFRREA SKANAVVIMN SITLVDAFLN ADKWSEMFCS IVARAKTVQI  420
ISSGVSGASG SLLLMYAELQ VLSPLVPTRE AYFLRYVEQN TENGNWAIVD FPIDSFHDQM  480
QPLNTNTPHE YTRKPSGCII QDMPNGYSQV KWVEHVEVDE KHVHETFAEY VKSGMAFGAN  540
RWLDVLQRQC ERIASLMARN ITDLGVISSA EARRNIMRLA QRMVRTFCVN ISTAYGQSWT  600
ALSETTKDTV RITTRKMCEP GQPTGVVLCA VSTTWLPFSH HQVFDLIRDQ HHQSLLEVLF  660
NGNSPHEVAH IANGSHPGNC ISLLRINVAS NSWHNVELML QESCIDNSGS LIVYSTVDVD  720
SIQLAMNGED SSNIPILPLG FSIVPVNPPE GISVNSHSPP SCLLTVAIQV LASNVPTAKP  780
NLSTVTTINN HLCATVNQIT SALSSTVTPV IASSKQEVS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136141DKQRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0133940.0AB013394.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MQD22.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010481400.10.0PREDICTED: homeobox-leucine zipper protein HDG5
SwissprotQ9FJS20.0HDG5_ARATH; Homeobox-leucine zipper protein HDG5
TrEMBLR0GUB60.0R0GUB6_9BRAS; Uncharacterized protein
STRINGAT5G46880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43562548
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7